Total number of results for Mamestra brassicae are 4
Download
as Fasta All
| NPID | Sequence | Length | Organism | Family | Name | PMID | Peptide_REF |
|---|---|---|---|---|---|---|---|
| NP05130 |
VIFTPKL
|
7 | Mamestra brassicae | Pyrokinin | Alpha-SG neuropeptide (Potential) | 9684333#Jacquin-Joly E., Burnet M., Francois M.-C., Ammar D., Nagnan-Meillour P., Descoins C.;#cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.;#Insect Biochem. Mol. Biol. 28:251-258(1998). | |
| NP05131 |
SLAYDDKVFENVEFTPRL
|
18 | Mamestra brassicae | Pyrokinin | Beta-SG neuropeptide (Potential) | 9684333#Jacquin-Joly E., Burnet M., Francois M.-C., Ammar D., Nagnan-Meillour P., Descoins C.;#cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.;#Insect Biochem. Mol. Biol. 28:251-258(1998). | |
| NP05132 |
TMNFSPRL
|
8 | Mamestra brassicae | Pyrokinin | Gamma-SG neuropeptide (Potential) | 9684333#Jacquin-Joly E., Burnet M., Francois M.-C., Ammar D., Nagnan-Meillour P., Descoins C.;#cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.;#Insect Biochem. Mol. Biol. 28:251-258(1998). | |
| NP05133 |
LADDMPATPADQEMYRPDPEQIDSRTKYFSPRL
|
33 | Mamestra brassicae | Pyrokinin | Pheromone biosynthesis-activating neuropeptide | 9684333#Jacquin-Joly E., Burnet M., Francois M.-C., Ammar D., Nagnan-Meillour P., Descoins C.;#cDNA cloning and sequence determination of the pheromone biosynthesis activating neuropeptide of Mamestra brassicae: a new member of the PBAN family.;#Insect Biochem. Mol. Biol. 28:251-258(1998). |